SCOPe 2.04: Domain d4qnsb_: 4qns B:

Lineage for d4qnsb_ (4qns B:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries)

8. Domain d4qnsb_: 4qns B: [258470]
   automated match to d4ldfa_
   complexed with act, edo, so4

Details for d4qnsb_

PDB Entry: 4qns, 1.5 Å

PDB Description: crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300

PDB Compounds: (B:) Histone acetyltransferase GCN5, putative

SCOPe Domain Sequences for d4qnsb_:

Sequence; same for both SEQRES and ATOM records:

>d4qnsb_ a.29.2.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ghkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgd
yktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

Timeline for d4qnsb_:

• d4qnsb_ is new in SCOPe 2.04-stable
  
• d4qnsb_ appears in SCOPe 2.05
  
• d4qnsb_ appears in the current release, SCOPe 2.08, called d4qnsb1