Lineage for d4qnsb1 (4qns B:1356-1460)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2708305Species Plasmodium falciparum [TaxId:36329] [237857] (4 PDB entries)
  8. 2708307Domain d4qnsb1: 4qns B:1356-1460 [258470]
    Other proteins in same PDB: d4qnsa2, d4qnsb2
    automated match to d4ldfa_
    complexed with act, edo, so4

Details for d4qnsb1

PDB Entry: 4qns (more details), 1.5 Å

PDB Description: crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
PDB Compounds: (B:) Histone acetyltransferase GCN5, putative

SCOPe Domain Sequences for d4qnsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnsb1 a.29.2.0 (B:1356-1460) automated matches {Plasmodium falciparum [TaxId: 36329]}
hkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgdy
ktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

SCOPe Domain Coordinates for d4qnsb1:

Click to download the PDB-style file with coordinates for d4qnsb1.
(The format of our PDB-style files is described here.)

Timeline for d4qnsb1: