Lineage for d4qnsa_ (4qns A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487717Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1487718Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1487790Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1487791Protein automated matches [190615] (4 species)
    not a true protein
  7. 1488069Species Plasmodium falciparum [TaxId:36329] [237857] (2 PDB entries)
  8. 1488070Domain d4qnsa_: 4qns A: [258469]
    automated match to d4ldfa_
    complexed with act, edo, so4

Details for d4qnsa_

PDB Entry: 4qns (more details), 1.5 Å

PDB Description: crystal structure of bromodomain from plasmodium faciparum gcn5, pf3d7_0823300
PDB Compounds: (A:) Histone acetyltransferase GCN5, putative

SCOPe Domain Sequences for d4qnsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qnsa_ a.29.2.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ghkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgd
yktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai

SCOPe Domain Coordinates for d4qnsa_:

Click to download the PDB-style file with coordinates for d4qnsa_.
(The format of our PDB-style files is described here.)

Timeline for d4qnsa_: