Lineage for d4qmca_ (4qmc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2015621Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2015622Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2015627Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2015739Protein Snake phospholipase A2 [48624] (38 species)
  7. 2015938Species Snake (Daboia russellii pulchella), different isoforms [TaxId:97228] [48630] (38 PDB entries)
    Uniprot P59071
  8. 2015943Domain d4qmca_: 4qmc A: [258466]
    automated match to d1tk4a_
    complexed with act, bso, gol, so4

Details for d4qmca_

PDB Entry: 4qmc (more details), 1.09 Å

PDB Description: Crystal structure of complex formed between phospholipase A2 and Biotin-sulfoxide at 1.09 A Resolution
PDB Compounds: (A:) Phospholipase A2 VRV-PL-VIIIa

SCOPe Domain Sequences for d4qmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qmca_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]}
sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
c

SCOPe Domain Coordinates for d4qmca_:

Click to download the PDB-style file with coordinates for d4qmca_.
(The format of our PDB-style files is described here.)

Timeline for d4qmca_: