Lineage for d4qn5b_ (4qn5 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1802176Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 1802177Superfamily b.68.1: Sialidases [50939] (3 families) (S)
  5. 1802584Family b.68.1.0: automated matches [191452] (1 protein)
    not a true family
  6. 1802585Protein automated matches [190692] (11 species)
    not a true protein
  7. 1802602Species Influenza a virus (a/mallard duck/alb/60/1976(h12n5)) [TaxId:352705] [258463] (1 PDB entry)
  8. 1802604Domain d4qn5b_: 4qn5 B: [258464]
    automated match to d3sala_
    complexed with ca, nag, sia

Details for d4qn5b_

PDB Entry: 4qn5 (more details), 1.7 Å

PDB Description: neuraminidase n5 binds lsta at the second sia binding site
PDB Compounds: (B:) Neuraminidase

SCOPe Domain Sequences for d4qn5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qn5b_ b.68.1.0 (B:) automated matches {Influenza a virus (a/mallard duck/alb/60/1976(h12n5)) [TaxId: 352705]}
peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
iwtsssstvfcgvssevpgwswddgailpfdidk

SCOPe Domain Coordinates for d4qn5b_:

Click to download the PDB-style file with coordinates for d4qn5b_.
(The format of our PDB-style files is described here.)

Timeline for d4qn5b_: