SCOPe 2.05: Domain d4qlvl_: 4qlv L:

Lineage for d4qlvl_ (4qlv L:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (70 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4qlvl_: 4qlv L: [258432]
   Other proteins in same PDB: d4qlvc_, d4qlvd_, d4qlve_, d4qlvf_, d4qlvg_, d4qlvh_, d4qlvm_, d4qlvp_, d4qlvq_, d4qlvr_, d4qlvs_, d4qlvt_, d4qlvu_, d4qlvv_
   automated match to d1rypm_
   complexed with 39q, mes, mg

Details for d4qlvl_

PDB Entry: 4qlv, 2.9 Å

PDB Description: yCP in complex with tripeptidic epoxyketone inhibitor 17

PDB Compounds: (L:) Proteasome subunit beta type-6

SCOPe Domain Sequences for d4qlvl_:

Sequence; same for both SEQRES and ATOM records:

>d4qlvl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qfnpygdnggtilgiagedfavlagdtrnitdysinsryepkvfdcgdnivmsangfaad
gdalvkrfknsvkwyhfdhndkklsinsaarniqhllygkrffpyyvhtiiagldedgkg
avysfdpvgsyereqcraggaaaslimpfldnqvnfknqyepgtngkvkkplkylsveev
iklvrdsftsaterhiqvgdgleilivtkdgvrkefyelkrd

Timeline for d4qlvl_:

• d4qlvl_ first appeared in SCOPe 2.04
  
• d4qlvl_ appears in SCOPe 2.06
  
• d4qlvl_ appears in the current release, SCOPe 2.08