Lineage for d1ppce_ (1ppc E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15330Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)
  8. 15378Domain d1ppce_: 1ppc E: [25843]

Details for d1ppce_

PDB Entry: 1ppc (more details), 1.8 Å

PDB Description: geometry of binding of the benzamidine-and arginine-based inhibitors n-alpha-(2-naphthyl-sulphonyl-glycyl)-dl-p-amidinophenylalanyl-piperidine (napap) and (2r,4r)-4-methyl-1-[n-alpha-(3-methyl-1,2,3,4-tetrahydro-8-quinolinesulphonyl)-l-arginyl]-2-piperidine carboxylic acid (mqpa) to human alpha-thrombin: x-ray crystallographic determination of the napap-trypsin complex and modeling of napap-thrombin and mqpa-thrombin

SCOP Domain Sequences for d1ppce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppce_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1ppce_:

Click to download the PDB-style file with coordinates for d1ppce_.
(The format of our PDB-style files is described here.)

Timeline for d1ppce_: