SCOPe 2.06: Domain d2tgta_: 2tgt A:

Lineage for d2tgta_ (2tgt A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (418 PDB entries)
   Uniprot P00760

8. Domain d2tgta_: 2tgt A: [25842]
   complexed with ca, moh

Details for d2tgta_

PDB Entry: 2tgt, 1.7 Å

PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography

PDB Compounds: (A:) trypsinogen

SCOPe Domain Sequences for d2tgta_:

Sequence; same for both SEQRES and ATOM records:

>d2tgta_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d2tgta_:

• d2tgta_ first appeared (with stable ids) in SCOP 1.55, called d2tgt__
  
• d2tgta_ appears in SCOPe 2.05
  
• d2tgta_ appears in SCOPe 2.07
  
• d2tgta_ appears in the current release, SCOPe 2.08