Lineage for d1tnk__ (1tnk -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 14823Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 14824Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 14909Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins)
  6. 15329Protein Trypsin(ogen) [50515] (6 species)
  7. 15330Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries)
  8. 15372Domain d1tnk__: 1tnk - [25840]

Details for d1tnk__

PDB Entry: 1tnk (more details), 1.8 Å

PDB Description: prediction of novel serine protease inhibitors

SCOP Domain Sequences for d1tnk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tnk__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d1tnk__:

Click to download the PDB-style file with coordinates for d1tnk__.
(The format of our PDB-style files is described here.)

Timeline for d1tnk__: