SCOPe 2.01: Domain d1btxa_: 1btx A:

Lineage for d1btxa_ (1btx A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (340 PDB entries)
   Uniprot P00760

8. Domain d1btxa_: 1btx A: [25837]
   complexed with 0zx, ca

Details for d1btxa_

PDB Entry: 1btx, 1.7 Å

PDB Description: Episelection: Novel Ki ~Nanomolar Inhibitors of Serine Proteases Selected by Binding or Chemistry on an Enzyme Surface

PDB Compounds: (A:) beta-trypsin

SCOPe Domain Sequences for d1btxa_:

Sequence; same for both SEQRES and ATOM records:

>d1btxa_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1btxa_:

• d1btxa_ first appeared (with stable ids) in SCOP 1.55
  
• d1btxa_ appears in SCOP 1.75
  
• d1btxa_ appears in SCOPe 2.02
  
• d1btxa_ appears in the current release, SCOPe 2.08