SCOPe 2.08: Domain d4qjib1: 4qji B:186-412

Lineage for d4qjib1 (4qji B:186-412)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.3: CoaB-like [102645] (2 families)
   combination of the Rossmann-like and Ribokinase-like topologies; mixed beta-sheet of 8 strands, order 32145678, strand 7 is antiparallel to the rest

5. Family c.72.3.0: automated matches [258365] (1 protein)
   not a true family

6. Protein automated matches [258366] (4 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [258367] (1 PDB entry)

8. Domain d4qjib1: 4qji B:186-412 [258368]
   Other proteins in same PDB: d4qjia2, d4qjib2
   automated match to d1u7ua_
   complexed with ctp, mg

Details for d4qjib1

PDB Entry: 4qji, 2.65 Å

PDB Description: crystal structure of the c-terminal ctp-binding domain of a phosphopantothenoylcysteine decarboxylase/phosphopantothenate- cysteine ligase with bound ctp from mycobacterium smegmatis

PDB Compounds: (B:) Phosphopantothenate--cysteine ligase

SCOPe Domain Sequences for d4qjib1:

Sequence, based on SEQRES records:

>d4qjib1 c.72.3.0 (B:186-412) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dmagvkalvtaggtrepldpvrfignrssgkqgyavarvlaqrgadvtliagntaglidp
agvemvhigsatqlrdavskhapdanvlvmaaavadfrpahvaaakikkgasepssidlv
rnddvlagavraradgqlpnmraivgfaaetgdangdvlfharaklerkgcdllvvnavg
enrafevdhndgwllsadgtesalehgsktlmatrivdsiaaflksq

Sequence, based on observed residues (ATOM records):

>d4qjib1 c.72.3.0 (B:186-412) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
dmagvkalvtaggtrepldpvrfignrssgkqgyavarvlaqrgadvtliagntaglidp
agvemvhigsatqlrdavskhapdanvlvmaaavadfrpahvaaakikkgasepssidlv
rnddvlagavraradgqlpnmraivgfaaetgdangdvlfharaklerkgcdllvvndgw
llsadgtesalehgsktlmatrivdsiaaflksq

Timeline for d4qjib1:

• d4qjib1 first appeared in SCOPe 2.04, called d4qjib_
  
• d4qjib1 appears in SCOPe 2.07