Lineage for d4qi9a_ (4qi9 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1872191Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 1872192Protein automated matches [190777] (19 species)
    not a true protein
  7. 1872409Species Yersinia pestis [TaxId:214092] [256028] (3 PDB entries)
  8. 1872412Domain d4qi9a_: 4qi9 A: [258364]
    automated match to d3tq8a_
    complexed with mtx

Details for d4qi9a_

PDB Entry: 4qi9 (more details), 2.3 Å

PDB Description: Crystal structure of dihydrofolate reductase from Yersinia pestis complexed with methotrexate
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d4qi9a_:

Sequence, based on SEQRES records: (download)

>d4qi9a_ c.71.1.0 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvigmenampwhlpadlawfkrntlnkpvimgrktfesigrplpgrln
ivissqpgtdervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaev
ggdthfpdyepdewesvfsefhdadeanshsycfeilerrgenlyfq

Sequence, based on observed residues (ATOM records): (download)

>d4qi9a_ c.71.1.0 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
miisliaalaadrvilpadlawfkrntlnkpvimgrktfesigrplpgrlnivissqpgt
dervtwaasieealafagnaeevmvmgggrvykqfldranrmylthidaevggdthfpdy
epdewesvfsefhdadeanshsycfeilerrgenlyfq

SCOPe Domain Coordinates for d4qi9a_:

Click to download the PDB-style file with coordinates for d4qi9a_.
(The format of our PDB-style files is described here.)

Timeline for d4qi9a_: