Lineage for d4qgib_ (4qgi B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. 1548436Species Human immunodeficiency virus type 1 lw12.3 isolate [TaxId:82834] [189723] (3 PDB entries)
  8. 1548441Domain d4qgib_: 4qgi B: [258360]
    automated match to d1a9ma_
    complexed with gol, roc

Details for d4qgib_

PDB Entry: 4qgi (more details), 1.9 Å

PDB Description: x-ray crystal structure of hiv-1 protease variant g48t/l89m in complex with saquinavir
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d4qgib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qgib_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 lw12.3 isolate [TaxId: 82834]}
pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmitgiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnmltqigctlnf

SCOPe Domain Coordinates for d4qgib_:

Click to download the PDB-style file with coordinates for d4qgib_.
(The format of our PDB-style files is described here.)

Timeline for d4qgib_: