SCOP 1.75: Domain d3ptba_: 3ptb A:

Lineage for d3ptba_ (3ptb A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (279 PDB entries)
   Uniprot P00760

8. Domain d3ptba_: 3ptb A: [25836]
   complexed with ben, ca

Details for d3ptba_

PDB Entry: 3ptb, 1.7 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors

PDB Compounds: (A:) beta-trypsin

SCOP Domain Sequences for d3ptba_:

Sequence; same for both SEQRES and ATOM records:

>d3ptba_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3ptba_:

• d3ptba_ first appeared (with stable ids) in SCOP 1.55, called d3ptb__
  
• d3ptba_ appears in SCOP 1.73
  
• d3ptba_ appears in SCOPe 2.01
  
• d3ptba_ appears in the current release, SCOPe 2.08