Lineage for d3ptb__ (3ptb -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d3ptb__: 3ptb - [25836]
Details for d3ptb__
PDB Entry: 3ptb (more details), 1.7 Å
PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors
SCOP Domain Sequences for d3ptb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ptb__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d3ptb__:
Click to download the PDB-style file with coordinates for d3ptb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ptb__:
- d3ptb__ appears in SCOP 1.57
- d3ptb__ appears in the current release, SCOPe 2.08, called d3ptba_
View in 3D