SCOPe 2.05: Domain d4qgpb_: 4qgp B:

Lineage for d4qgpb_ (4qgp B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.0: automated matches [191410] (1 protein)
   not a true family

6. Protein automated matches [190562] (4 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [189451] (1 PDB entry)

8. Domain d4qgpb_: 4qgp B: [258357]
   automated match to d3obca_
   complexed with cl, mg, na, pg4, pge

Details for d4qgpb_

PDB Entry: 4qgp, 1.78 Å

PDB Description: crystal structure of a pyrophosphatase (af1178) from archaeoglobus fulgidus dsm 4304 at 1.80 a resolution

PDB Compounds: (B:) pyrophosphatase

SCOPe Domain Sequences for d4qgpb_:

Sequence; same for both SEQRES and ATOM records:

>d4qgpb_ a.204.1.0 (B:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
ihhhhhhmeelldilrefrdsrgwlkyhtpknlavsisievaelleifqwtrssdeefev
lerrkgeveeeiadvliyllflcdvaeinpieavkrkmeknerkypk

Timeline for d4qgpb_:

• d4qgpb_ first appeared in SCOPe 2.04
  
• d4qgpb_ is called d4qgpb1 in SCOPe 2.06
  
• d4qgpb_ appears in the current release, SCOPe 2.08, called d4qgpb1