| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Staphylococcus epidermidis [TaxId:1282] [258352] (2 PDB entries) |
| Domain d4qeca_: 4qec A: [258355] automated match to d3v2hb_ complexed with nap, so4 |
PDB Entry: 4qec (more details), 1.9 Å
SCOPe Domain Sequences for d4qeca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qeca_ c.2.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 1282]}
mkknvlitggfkgigkqvaleflkndyhvcitsryfekekriphlfssyeenisfyqldv
tdeeqvneiinkivkkfgrldvlvnnagislsdglltetkttdfnkmintnilgtyfcmk
yalkhmqkvscgaivnissitglsgfpysilygstkhavigltkgaavefadkgikinav
apgiiktetlqkeidsgefsedsissihpmqklgttldvakgiyflanednnfitghvls
idggylsq
Timeline for d4qeca_: