Lineage for d4qeda_ (4qed A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848610Species Staphylococcus epidermidis [TaxId:1282] [258352] (2 PDB entries)
  8. 2848613Domain d4qeda_: 4qed A: [258353]
    automated match to d3v2hb_
    complexed with nap, so4

Details for d4qeda_

PDB Entry: 4qed (more details), 1.85 Å

PDB Description: ElxO Y152F with NADPH Bound
PDB Compounds: (A:) ElxO

SCOPe Domain Sequences for d4qeda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qeda_ c.2.1.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 1282]}
mkknvlitggfkgigkqvaleflkndyhvcitsryfekekriphlfssyeenisfyqldv
tdeeqvneiinkivkkfgrldvlvnnagislsdglltetkttdfnkmintnilgtyfcmk
yalkhmqkvscgaivnissitglsgfpysilfgstkhavigltkgaavefadkgikinav
apgiiktetlqkeidsgefsedsissihpmqklgttldvakgiyflanednnfitghvls
idggylsq

SCOPe Domain Coordinates for d4qeda_:

Click to download the PDB-style file with coordinates for d4qeda_.
(The format of our PDB-style files is described here.)

Timeline for d4qeda_: