Lineage for d4qe3a_ (4qe3 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2474355Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2474356Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2474895Family c.69.1.3: Mycobacterial antigens [53491] (5 protein domains)
    automatically mapped to Pfam PF00756
  6. 2474916Protein automated matches [227016] (2 species)
    not a true protein
  7. 2474925Species Mycobacterium tuberculosis [TaxId:83332] [258342] (8 PDB entries)
  8. 2474927Domain d4qe3a_: 4qe3 A: [258350]
    automated match to d1sfra_
    complexed with 1n7, acy; mutant

Details for d4qe3a_

PDB Entry: 4qe3 (more details), 1.35 Å

PDB Description: Crystal structure of Antigen 85C-H260Q mutant
PDB Compounds: (A:) Diacylglycerol acyltransferase/mycolyltransferase Ag85C

SCOPe Domain Sequences for d4qe3a_:

Sequence, based on SEQRES records: (download)

>d4qe3a_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqsgls
vimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavglsm
sggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwgpssdpa
wkrndpmvqiprlvanntriwvycgngtpsdlggdnipakflegltlrtnqtfrdtyaad
ggrngvfnfppngtqswpywneqlvamkadiqhvlng

Sequence, based on observed residues (ATOM records): (download)

>d4qe3a_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lpveylqvpsasmgrdikvqfqgggphavylldglraqddyngwdintpafeeyyqsgls
vimpvggqssfytdwyqpsqsngqnytykwetfltrempawlqankgvsptgnaavglsm
sggsalilaayypqqfpyaaslsgflnpsegwwptliglamndsggynansmwgpssdpa
wkrndpmvqiprlvanntriwvycgnipakflegltlrtnqtfrdtyaadggrngvfnfp
pngtqswpywneqlvamkadiqhvlng

SCOPe Domain Coordinates for d4qe3a_:

Click to download the PDB-style file with coordinates for d4qe3a_.
(The format of our PDB-style files is described here.)

Timeline for d4qe3a_: