Lineage for d2ptn__ (2ptn -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d2ptn__: 2ptn - [25835]
Details for d2ptn__
PDB Entry: 2ptn (more details), 1.55 Å
PDB Description: on the disordered activation domain in trypsinogen. chemical labelling and low-temperature crystallography
SCOP Domain Sequences for d2ptn__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ptn__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d2ptn__:
Click to download the PDB-style file with coordinates for d2ptn__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ptn__:
- d2ptn__ appears in SCOP 1.57
- d2ptn__ appears in the current release, SCOPe 2.08, called d2ptna_
View in 3D