| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.6: Cadherin-like [49313] (4 families) ![]() |
| Family b.1.6.1: Cadherin [49314] (4 proteins) |
| Protein E-cadherin (epithelial) [49317] (2 species) synonym: uvomorulin |
| Species Mouse (Mus musculus) [TaxId:10090] [49318] (14 PDB entries) |
| Domain d4qd2j2: 4qd2 J:102-213 [258348] Other proteins in same PDB: d4qd2c1, d4qd2c2, d4qd2d1, d4qd2d2, d4qd2d3, d4qd2h1, d4qd2h2, d4qd2h3, d4qd2i1, d4qd2i2, d4qd2i3 automated match to d1ff5a2 complexed with ca |
PDB Entry: 4qd2 (more details), 2.4 Å
SCOPe Domain Sequences for d4qd2j2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qd2j2 b.1.6.1 (J:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]}
ndnrpeftqevfegsvaegavpgtsvmkvsatdadddvntynaaiaytivsqdpelphkn
mftvnrdtgvisvltsgldresyptytlvvqaadlqgeglsttakavitvkd
Timeline for d4qd2j2: