Class b: All beta proteins [48724] (180 folds) |
Fold b.26: SMAD/FHA domain [49878] (1 superfamily) sandwich; 11 strands in 2 sheets; greek-key |
Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) has a few short helices inserted in loops |
Family b.26.1.0: automated matches [191616] (1 protein) not a true family |
Protein automated matches [191125] (8 species) not a true protein |
Species Corynebacterium glutamicum [TaxId:196627] [258340] (1 PDB entry) |
Domain d4qcja_: 4qcj A: [258341] automated match to d2xt9b_ |
PDB Entry: 4qcj (more details), 2 Å
SCOPe Domain Sequences for d4qcja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qcja_ b.26.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]} lpagsallvvkrgpnagarflldqptttagrhpesdiflddvtvsrrhaefrinegefev vdvgslngtyvnreprnaqvmqtgdeiqigkfrlvflagpa
Timeline for d4qcja_: