Lineage for d4qcja_ (4qcj A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778062Fold b.26: SMAD/FHA domain [49878] (1 superfamily)
    sandwich; 11 strands in 2 sheets; greek-key
  4. 2778063Superfamily b.26.1: SMAD/FHA domain [49879] (5 families) (S)
    has a few short helices inserted in loops
  5. 2778206Family b.26.1.0: automated matches [191616] (1 protein)
    not a true family
  6. 2778207Protein automated matches [191125] (8 species)
    not a true protein
  7. 2778218Species Corynebacterium glutamicum [TaxId:196627] [258340] (1 PDB entry)
  8. 2778219Domain d4qcja_: 4qcj A: [258341]
    automated match to d2xt9b_

Details for d4qcja_

PDB Entry: 4qcj (more details), 2 Å

PDB Description: Crystal Structure of OdhI from Corynebacterium glutamicum
PDB Compounds: (A:) Oxoglutarate dehydrogenase inhibitor

SCOPe Domain Sequences for d4qcja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qcja_ b.26.1.0 (A:) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
lpagsallvvkrgpnagarflldqptttagrhpesdiflddvtvsrrhaefrinegefev
vdvgslngtyvnreprnaqvmqtgdeiqigkfrlvflagpa

SCOPe Domain Coordinates for d4qcja_:

Click to download the PDB-style file with coordinates for d4qcja_.
(The format of our PDB-style files is described here.)

Timeline for d4qcja_: