Lineage for d1tld__ (1tld -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.2: Eukaryotic proteases [50514] (33 proteins) Protein Trypsin(ogen) [50515] (6 species) 
Species Cow (Bos taurus) [TaxId:9913] [50516] (125 PDB entries) 
Domain d1tld__: 1tld - [25834]
Details for d1tld__
PDB Entry: 1tld (more details), 1.5 Å
PDB Description: crystal structure of bovine beta-trypsin at 1.5 angstroms resolution in a crystal form with low molecular packing density. active site geometry, ion pairs and solvent structure
SCOP Domain Sequences for d1tld__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tld__ b.47.1.2 (-) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
SCOP Domain Coordinates for d1tld__:
Click to download the PDB-style file with coordinates for d1tld__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1tld__:
- d1tld__ appears in SCOP 1.57
- d1tld__ appears in the current release, SCOPe 2.08, called d1tlda_
View in 3D