Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Domain d4qaca_: 4qac A: [258336] automated match to d4alxa_ complexed with kk3, nag, po4 |
PDB Entry: 4qac (more details), 2.1 Å
SCOPe Domain Sequences for d4qaca_:
Sequence, based on SEQRES records: (download)
>d4qaca_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe ildvtqkknsvtysccpeayedvevslnfrkkg
>d4qaca_ b.96.1.1 (A:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]} dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildv tqkknsvtysccpeayedvevslnfrkkg
Timeline for d4qaca_: