Lineage for d4q9bb_ (4q9b B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761398Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries)
  8. 2761400Domain d4q9bb_: 4q9b B: [258335]
    automated match to d4jvwa_

Details for d4q9bb_

PDB Entry: 4q9b (more details), 1.5 Å

PDB Description: IgNAR antibody domain C2
PDB Compounds: (B:) novel antigen receptor

SCOPe Domain Sequences for d4q9bb_:

Sequence, based on SEQRES records: (download)

>d4q9bb_ b.1.1.0 (B:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
avllrdptveeiwidksatlvcevlstvsagvvvswmvngkvrnegvqmeptkmsgnqyl
tisrltssveewqsgveytcsakqdqsstpvvkrtrka

Sequence, based on observed residues (ATOM records): (download)

>d4q9bb_ b.1.1.0 (B:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
avllrdptveeiwidksatlvcevlvsagvvvswmvngkvrnegvqmeptkmsgnqylti
srltssveewqsgveytcsakqdpvvkrtrka

SCOPe Domain Coordinates for d4q9bb_:

Click to download the PDB-style file with coordinates for d4q9bb_.
(The format of our PDB-style files is described here.)

Timeline for d4q9bb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q9ba_