Lineage for d4q9ca_ (4q9c A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519205Species Ginglymostoma cirratum [TaxId:7801] [257940] (4 PDB entries)
  8. 1519210Domain d4q9ca_: 4q9c A: [258334]
    automated match to d2z93a1
    complexed with cl, na, pg4

Details for d4q9ca_

PDB Entry: 4q9c (more details), 2.8 Å

PDB Description: IgNAR antibody domain C3
PDB Compounds: (A:) novel antigen receptor

SCOPe Domain Sequences for d4q9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q9ca_ b.1.1.0 (A:) automated matches {Ginglymostoma cirratum [TaxId: 7801]}
veptkphlrllppspeeiqstssatltclirgfypdkvsvswqkddvsvsanvtnfptal
eqdltfstrsllnltavewksgakytctashppsqstvkrvirnq

SCOPe Domain Coordinates for d4q9ca_:

Click to download the PDB-style file with coordinates for d4q9ca_.
(The format of our PDB-style files is described here.)

Timeline for d4q9ca_: