SCOPe 2.08: Domain d4q9ba_: 4q9b A:

Lineage for d4q9ba_ (4q9b A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries)

8. Domain d4q9ba_: 4q9b A: [258333]
   automated match to d4jvwa_

Details for d4q9ba_

PDB Entry: 4q9b, 1.5 Å

PDB Description: IgNAR antibody domain C2

PDB Compounds: (A:) novel antigen receptor

SCOPe Domain Sequences for d4q9ba_:

Sequence; same for both SEQRES and ATOM records:

>d4q9ba_ b.1.1.0 (A:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
seiavllrdptveeiwidksatlvcevlstvsagvvvswmvngkvrnegvqmeptkmsgn
qyltisrltssveewqsgveytcsakqdqsstpvvkrtrka

Timeline for d4q9ba_:

• d4q9ba_ first appeared in SCOPe 2.04
  
• d4q9ba_ appears in SCOPe 2.07