| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries) |
| Domain d4q9ba_: 4q9b A: [258333] automated match to d4jvwa_ |
PDB Entry: 4q9b (more details), 1.5 Å
SCOPe Domain Sequences for d4q9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q9ba_ b.1.1.0 (A:) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
seiavllrdptveeiwidksatlvcevlstvsagvvvswmvngkvrnegvqmeptkmsgn
qyltisrltssveewqsgveytcsakqdqsstpvvkrtrka
Timeline for d4q9ba_: