SCOPe 2.04: Domain d4q97b_: 4q97 B:

Lineage for d4q97b_ (4q97 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Ginglymostoma cirratum [TaxId:7801] [257940] (4 PDB entries)

8. Domain d4q97b_: 4q97 B: [258332]
   automated match to d2a77h1

Details for d4q97b_

PDB Entry: 4q97, 2.4 Å

PDB Description: IgNAR antibody domain C1

PDB Compounds: (B:) novel antigen receptor

SCOPe Domain Sequences for d4q97b_:

Sequence; same for both SEQRES and ATOM records:

>d4q97b_ b.1.1.0 (B:) automated matches {Ginglymostoma cirratum [TaxId: 7801]}
shmgippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfatt
spvktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirs

Timeline for d4q97b_:

• d4q97b_ is new in SCOPe 2.04-stable
  
• d4q97b_ appears in SCOPe 2.05
  
• d4q97b_ appears in the current release, SCOPe 2.08, called d4q97b1