![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries) |
![]() | Domain d4q97b1: 4q97 B:137-241 [258332] Other proteins in same PDB: d4q97a2, d4q97b2 automated match to d2a77h1 |
PDB Entry: 4q97 (more details), 2.4 Å
SCOPe Domain Sequences for d4q97b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q97b1 b.1.1.0 (B:137-241) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} gippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfattspv ktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirs
Timeline for d4q97b1: