Lineage for d4q97a1 (4q97 A:137-241)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2761398Species Nurse shark (Ginglymostoma cirratum) [TaxId:7801] [257940] (5 PDB entries)
  8. 2761403Domain d4q97a1: 4q97 A:137-241 [258331]
    Other proteins in same PDB: d4q97a2, d4q97b2
    automated match to d2a77h1

Details for d4q97a1

PDB Entry: 4q97 (more details), 2.4 Å

PDB Description: IgNAR antibody domain C1
PDB Compounds: (A:) novel antigen receptor

SCOPe Domain Sequences for d4q97a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q97a1 b.1.1.0 (A:137-241) automated matches {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]}
gippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfattspv
ktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirs

SCOPe Domain Coordinates for d4q97a1:

Click to download the PDB-style file with coordinates for d4q97a1.
(The format of our PDB-style files is described here.)

Timeline for d4q97a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4q97a2