| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.0: automated matches [191400] (1 protein) not a true family |
| Protein automated matches [190526] (26 species) not a true protein |
| Species Coral (Discosoma sp.) [TaxId:86600] [258320] (6 PDB entries) |
| Domain d4q7ta_: 4q7t A: [258323] Other proteins in same PDB: d4q7tb2 automated match to d3ztfa_ |
PDB Entry: 4q7t (more details), 1.94 Å
SCOPe Domain Sequences for d4q7ta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q7ta_ d.22.1.0 (A:) automated matches {Coral (Discosoma sp.) [TaxId: 86600]}
aiikefmrfkvrmegtvnghefeiegegegrpyegfqtaklkvtkggplpfawdilsplx
skayvkhpadipdyfklsfpegfkwervmnyedggvvtvtqdsslqdgefiykvkmrgtn
fpsdgpvmqkktmgweassermypedgalkgeirmrlklkdgghytsevkttykakksvq
lpgayivgiklditshnedytiveqyeraegrhst
Timeline for d4q7ta_: