Lineage for d4q6ba_ (4q6b A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143989Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2143990Protein automated matches [190646] (70 species)
    not a true protein
  7. 2144105Species Desulfitobacterium hafniense [TaxId:272564] [228009] (2 PDB entries)
  8. 2144106Domain d4q6ba_: 4q6b A: [258319]
    automated match to d4mlca_
    complexed with ca, edo, leu

Details for d4q6ba_

PDB Entry: 4q6b (more details), 1.67 Å

PDB Description: Crystal Structure of ABC Transporter Substrate-Binding Protein fromDesulfitobacterium hafniense complex with Leu
PDB Compounds: (A:) Extracellular ligand-binding receptor

SCOPe Domain Sequences for d4q6ba_:

Sequence, based on SEQRES records: (download)

>d4q6ba_ c.93.1.0 (A:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
eeifigvawpfaslddlfaeglelavqeineqggvqgrklslvkaddeaelekglaiaqa
fadnagiqavighrnsfisipaasiydqaglvmlspastspdltdhgyihvfrnipsdqe
iarqlaiylaeqghermviyytddsygnglanafedyaraqgitivdrfnyygnlkdler
lydkwqafgmdgifiaktatgggteflvdaksvgievpliagnswdalsltedienigmt
aegllvgsffnpqrpdsrtqdfveafrreygqpptsyaaagydavillaealeksdlthp
atlaqglrdlgpwegvmgmhrfdgrgddigdlvvlkkmkdgrfeyl

Sequence, based on observed residues (ATOM records): (download)

>d4q6ba_ c.93.1.0 (A:) automated matches {Desulfitobacterium hafniense [TaxId: 272564]}
eeifigvawpfaslddlfaeglelavqeineqggvqgrklslvkaddeaelekglaiaqa
fadnagiqavighrnsfisipaasiydqaglvmlspastspdltdhgyihvfrnipsdqe
iarqlaiylaeqghermviyytddsygnglanafedyaraqgitivdrfnyygnlkdler
lydkwqafgmdgifiaktatgggteflvdaksvgievpliagnswdamtaegllvgsffn
pqrpdsrtqdfveafrreygqpptsyaaagydavillaealeksdlthpatlaqglrdlg
pwegvmgmhrfdgrgddigdlvvlkkmkdgrfeyl

SCOPe Domain Coordinates for d4q6ba_:

Click to download the PDB-style file with coordinates for d4q6ba_.
(The format of our PDB-style files is described here.)

Timeline for d4q6ba_: