| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
| Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
| Protein automated matches [191021] (2 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries) |
| Domain d4q59b1: 4q59 B:38-153 [258317] Other proteins in same PDB: d4q59a2, d4q59b2 automated match to d3f7pa1 |
PDB Entry: 4q59 (more details), 2.3 Å
SCOPe Domain Sequences for d4q59b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q59b1 a.40.1.1 (B:38-153) automated matches {Human (Homo sapiens) [TaxId: 9606]}
derdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprekgrmrf
hklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvsg
Timeline for d4q59b1: