Lineage for d4q57b2 (4q57 B:154-263)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712187Species Mouse (Mus musculus) [TaxId:10090] [255300] (3 PDB entries)
  8. 2712188Domain d4q57b2: 4q57 B:154-263 [258316]
    Other proteins in same PDB: d4q57b1, d4q57b3
    automated match to d1mb8a2
    complexed with ca, cl, edo, gol, mg

Details for d4q57b2

PDB Entry: 4q57 (more details), 1.8 Å

PDB Description: Crystal structure of the plectin 1a actin-binding domain/N-terminal domain of calmodulin complex
PDB Compounds: (B:) Plectin

SCOPe Domain Sequences for d4q57b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q57b2 a.40.1.0 (B:154-263) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsedmtakeklllwsqrmvegyqglrcdnfttswrdgrlfnaiihrhkpmlidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

SCOPe Domain Coordinates for d4q57b2:

Click to download the PDB-style file with coordinates for d4q57b2.
(The format of our PDB-style files is described here.)

Timeline for d4q57b2: