Lineage for d4q57b1 (4q57 B:23-153)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712088Protein automated matches [191021] (2 species)
    not a true protein
  7. 2712099Species Mouse (Mus musculus) [TaxId:10090] [258314] (1 PDB entry)
  8. 2712100Domain d4q57b1: 4q57 B:23-153 [258315]
    Other proteins in same PDB: d4q57b2, d4q57b3
    automated match to d1mb8a1
    complexed with ca, cl, edo, gol, mg

Details for d4q57b1

PDB Entry: 4q57 (more details), 1.8 Å

PDB Description: Crystal structure of the plectin 1a actin-binding domain/N-terminal domain of calmodulin complex
PDB Compounds: (B:) Plectin

SCOPe Domain Sequences for d4q57b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q57b1 a.40.1.1 (B:23-153) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dnlylavlrasegkkderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllev
lsgdslprekgrmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiil
hfqisdiqvsg

SCOPe Domain Coordinates for d4q57b1:

Click to download the PDB-style file with coordinates for d4q57b1.
(The format of our PDB-style files is described here.)

Timeline for d4q57b1: