Lineage for d4q5eb_ (4q5e B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. Protein automated matches [190118] (16 species)
    not a true protein
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)
  8. Domain d4q5eb_: 4q5e B: [258313]
    Other proteins in same PDB: d4q5ec1, d4q5ec2
    automated match to d3rula_

Details for d4q5eb_

PDB Entry: 4q5e (more details), 1.87 Å

PDB Description: shigella effector kinase ospg bound to e2-ub ubch7-ub conjugate
PDB Compounds: (B:) Polyubiquitin

SCOPe Domain Sequences for d4q5eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q5eb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgc

SCOPe Domain Coordinates for d4q5eb_ are not available.

Timeline for d4q5eb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4q5ec1, d4q5ec2