Lineage for d4q4ze_ (4q4z E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2017141Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 2017142Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 2017143Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 2017184Protein automated matches [257263] (2 species)
    not a true protein
  7. 2017187Species Thermus thermophilus [TaxId:300852] [257264] (3 PDB entries)
  8. 2017189Domain d4q4ze_: 4q4z E: [258310]
    Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4zd_, d4q4zf1, d4q4zf2, d4q4zf3
    automated match to d1i6ve_
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4ze_

PDB Entry: 4q4z (more details), 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex
PDB Compounds: (E:) DNA-directed RNA polymerase subunit omega

SCOPe Domain Sequences for d4q4ze_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4ze_ a.143.1.1 (E:) automated matches {Thermus thermophilus [TaxId: 300852]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnav
twamkelltgrlvfgenlvpedrlqkemerlypv

SCOPe Domain Coordinates for d4q4ze_:

Click to download the PDB-style file with coordinates for d4q4ze_.
(The format of our PDB-style files is described here.)

Timeline for d4q4ze_: