Lineage for d4q4zd_ (4q4z D:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2249905Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2249906Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2249995Family e.29.1.2: RNA-polymerase beta-prime [64490] (3 proteins)
  6. 2250025Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2250031Species Thermus thermophilus [TaxId:274] [75610] (14 PDB entries)
    Uniprot Q8RQE8; part of multichain biological unit
  8. 2250055Domain d4q4zd_: 4q4z D: [258309]
    Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4ze_, d4q4zf1, d4q4zf2, d4q4zf3
    automated match to d1smyd_
    protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4zd_

PDB Entry: 4q4z (more details), 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex
PDB Compounds: (D:) DNA-directed RNA polymerase subunit beta'

SCOPe Domain Sequences for d4q4zd_:

Sequence, based on SEQRES records: (download)

>d4q4zd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggvagaaditqglprviel
fearrpkakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveag
qpltrgaidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevt
dpgdsrllegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqn
tthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkea

Sequence, based on observed residues (ATOM records): (download)

>d4q4zd_ e.29.1.2 (D:) RNA-polymerase beta-prime {Thermus thermophilus [TaxId: 274]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtksivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfskyivldpkgailngvpvekrqlltdeeyrelrygkqetyplppgvdalvkdg
eevvkgqelapgvvsrldgvalyrfprrvrveyvkkeraglrlplaawvekeaykpgeil
aelpepylfraeeegvvelkeleegaflvlrredepvatyflpvgmtplvvhgeivekgq
plaeakgllrmprqvraaqveaeeegetvyltlflewtepkdyrvqphmnvvvpegarve
agdkivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevstgdrvapgdvla
dggkvksdvygrvevdlvrnvvrvvesydidarmgaeaiqqllkeldlealekelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdalldngrrgapvtnpgsdrplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekgiapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgaglefatpeealaahergevalnapikvagretsvgrlkyv
fanpdeallavahgivdlqdvvtvrymgkrletspgrilfarivaeavedekvaweliql
dvpqeknslkdlvyqaflrlgmektarlldalkyygftfsttsgitigiddavipeekkq
yleeadrkllqieqayemgfltdrerydqilqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcglrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvtheivvreadcgttnyisvplfqpdevtrslrlrkradiea
glygrvlarevevlgvrleegrylsmddvhllikaaeageiqevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgivaaqsigepgtqltmrtfhtggitqglprvielfearrp
kakaviseidgvvrieeteeklsvfvesegfskeyklpkearllvkdgdyveagqpltrg
aidphqlleakgpeaverylveeiqkvyraqgvklhdkhieivvrqmmkyvevtdpgdsr
llegqvlekwdvealnerliaegktpvawkpllmgvtksalstkswlsaasfqntthvlt
eaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqktlkaieearkea

SCOPe Domain Coordinates for d4q4zd_:

Click to download the PDB-style file with coordinates for d4q4zd_.
(The format of our PDB-style files is described here.)

Timeline for d4q4zd_: