SCOPe 2.05: Domain d4q4zf2: 4q4z F:258-318

Lineage for d4q4zf2 (4q4z F:258-318)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families)

5. Family a.4.13.0: automated matches [254211] (1 protein)
   not a true family

6. Protein automated matches [254475] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries)

8. Domain d4q4zf2: 4q4z F:258-318 [258307]
   Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4zd_, d4q4ze_, d4q4zf1
   automated match to d1smyf1
   protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4zf2

PDB Entry: 4q4z, 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex

PDB Compounds: (F:) RNA polymerase sigma factor SigA

SCOPe Domain Sequences for d4q4zf2:

Sequence; same for both SEQRES and ATOM records:

>d4q4zf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 300852]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

Timeline for d4q4zf2:

• d4q4zf2 first appeared in SCOPe 2.04
  
• d4q4zf2 appears in SCOPe 2.06
  
• d4q4zf2 appears in the current release, SCOPe 2.08