![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (4 families) ![]() |
![]() | Family a.4.13.0: automated matches [254211] (1 protein) not a true family |
![]() | Protein automated matches [254475] (3 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:300852] [257268] (3 PDB entries) |
![]() | Domain d4q4zf2: 4q4z F:258-318 [258307] Other proteins in same PDB: d4q4za1, d4q4za2, d4q4zb1, d4q4zb2, d4q4zc_, d4q4zd_, d4q4ze_, d4q4zf1 automated match to d1smyf1 protein/DNA complex; protein/RNA complex; complexed with 2tm, atp, mg, zn |
PDB Entry: 4q4z (more details), 2.9 Å
SCOPe Domain Sequences for d4q4zf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q4zf2 a.4.13.0 (F:258-318) automated matches {Thermus thermophilus [TaxId: 300852]} iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl e
Timeline for d4q4zf2: