Lineage for d4q4zb2 (4q4z B:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684408Species Thermus thermophilus [TaxId:274] [75595] (14 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 1684454Domain d4q4zb2: 4q4z B:50-172 [258302]
    Other proteins in same PDB: d4q4za1, d4q4zb1, d4q4zc_, d4q4zd_, d4q4ze_, d4q4zf1, d4q4zf2, d4q4zf3
    automated match to d1smya2
    protein/DNA complex; complexed with 2tm, atp, mg, zn

Details for d4q4zb2

PDB Entry: 4q4z (more details), 2.9 Å

PDB Description: Thermus thermophilus RNA polymerase de novo transcription initiation complex
PDB Compounds: (B:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d4q4zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q4zb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d4q4zb2:

Click to download the PDB-style file with coordinates for d4q4zb2.
(The format of our PDB-style files is described here.)

Timeline for d4q4zb2: