Lineage for d4q2kd_ (4q2k D:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1545555Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1545556Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)
  7. 1545557Species Cow (Bos taurus) [TaxId:9913] [50523] (59 PDB entries)
    Uniprot P00766
  8. 1545634Domain d4q2kd_: 4q2k D: [258294]
    automated match to d1k2i1_
    complexed with 5bf

Details for d4q2kd_

PDB Entry: 4q2k (more details), 2.2 Å

PDB Description: Bovine alpha chymotrypsin bound to a cyclic peptide inhibitor, 5b
PDB Compounds: (D:) chymotrypsinogen a

SCOPe Domain Sequences for d4q2kd_:

Sequence, based on SEQRES records: (download)

>d4q2kd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
tlaan

Sequence, based on observed residues (ATOM records): (download)

>d4q2kd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
vvagefdqgsssekiqklkiakvfknskinnditllklstaasfsqtvsavclpsasddf
aagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmg
dsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan

SCOPe Domain Coordinates for d4q2kd_:

Click to download the PDB-style file with coordinates for d4q2kd_.
(The format of our PDB-style files is described here.)

Timeline for d4q2kd_: