Lineage for d1exfa_ (1exf A:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) 
Family b.47.1.1: Prokaryotic proteases [50495] (9 proteins) 
Protein Epidermolytic (exfoliative) toxin A [50510] (1 species) Species Staphylococcus aureus [TaxId:1280] [50511] (2 PDB entries) 
Domain d1exfa_: 1exf A: [25829]
Details for d1exfa_
PDB Entry: 1exf (more details), 2.1 Å
PDB Description: exfoliative toxin a
SCOP Domain Sequences for d1exfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1exfa_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus}
vsaeeikkheekwnkyygvnafnlpkelfskvdekdrqkypyntignvfvkgqtsatgvl
igkntvltnrhiakfangdpskvsfrpsintddngntetpygeyevkeilqepfgagvdl
alirlkpdqngvslgdkispakigtsndlkdgdkleligypfdhkvnqmhrseielttls
rglryygftvpgnsgsgifnsngelvgihsskvshldrehqinygvgignyvkriinekn
e
SCOP Domain Coordinates for d1exfa_:
Click to download the PDB-style file with coordinates for d1exfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1exfa_:
- d1exfa_ appears in SCOP 1.57
- d1exfa_ appears in the current release, SCOPe 2.08
View in 3D