| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
| Family d.298.1.0: automated matches [191658] (1 protein) not a true family |
| Protein automated matches [191236] (5 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [257085] (4 PDB entries) |
| Domain d4q2ud_: 4q2u D: [258283] automated match to d2otra_ protein/DNA complex; complexed with so4 |
PDB Entry: 4q2u (more details), 1.8 Å
SCOPe Domain Sequences for d4q2ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q2ud_ d.298.1.0 (D:) automated matches {Escherichia coli [TaxId: 83333]}
qrdieysgqyskdvklaqkrhkdmnklkylmtllinntlplpavykdhplqgswkgyrda
hvepdwiliykltdkllrfertgthaalfg
Timeline for d4q2ud_: