Lineage for d4q1sc_ (4q1s C:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1936658Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries)
  8. 1936734Domain d4q1sc_: 4q1s C: [258264]
    Other proteins in same PDB: d4q1sa_, d4q1sb_, d4q1se_, d4q1sg_, d4q1si_, d4q1sj_, d4q1sk_, d4q1sl_, d4q1sn_, d4q1so_, d4q1ss_, d4q1su_, d4q1sw_, d4q1sx_, d4q1sy_, d4q1sz_
    automated match to d1rypd_
    complexed with 2yd

Details for d4q1sc_

PDB Entry: 4q1s (more details), 2.6 Å

PDB Description: Yeast 20S proteasome in Complex with Kendomycin
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d4q1sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q1sc_ d.153.1.4 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q

SCOPe Domain Coordinates for d4q1sc_:

Click to download the PDB-style file with coordinates for d4q1sc_.
(The format of our PDB-style files is described here.)

Timeline for d4q1sc_: