Lineage for d4q0ha1 (4q0h A:1-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970344Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) (S)
    alpha-beta(2)-alpha(2)-beta(3)
  5. 2970589Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
    Pfam PF08446; PAS_2
  6. 2970590Protein Bacteriophytochrome BphP [160672] (3 species)
  7. 2970595Species Deinococcus radiodurans [TaxId:243230] [258259] (1 PDB entry)
  8. 2970596Domain d4q0ha1: 4q0h A:1-130 [258260]
    Other proteins in same PDB: d4q0ha2, d4q0ha3, d4q0ha4
    automated match to d2o9ba2
    complexed with cl, ipa, lbv

Details for d4q0ha1

PDB Entry: 4q0h (more details), 1.16 Å

PDB Description: Deinococcus radiodurans BphP PAS-GAF
PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d4q0ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4q0ha1 d.110.3.9 (A:1-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 243230]}
msrdplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaat
flgqeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvge
llilefepte

SCOPe Domain Coordinates for d4q0ha1:

Click to download the PDB-style file with coordinates for d4q0ha1.
(The format of our PDB-style files is described here.)

Timeline for d4q0ha1: