| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families) ![]() alpha-beta(2)-alpha(2)-beta(3) |
| Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins) Pfam PF08446; PAS_2 |
| Protein Bacteriophytochrome BphP [160672] (3 species) |
| Species Deinococcus radiodurans [TaxId:243230] [258259] (1 PDB entry) |
| Domain d4q0ha1: 4q0h A:1-130 [258260] Other proteins in same PDB: d4q0ha2, d4q0ha3, d4q0ha4 automated match to d2o9ba2 complexed with cl, ipa, lbv |
PDB Entry: 4q0h (more details), 1.16 Å
SCOPe Domain Sequences for d4q0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q0ha1 d.110.3.9 (A:1-130) Bacteriophytochrome BphP {Deinococcus radiodurans [TaxId: 243230]}
msrdplpffpplylggpeittencerepihipgsiqphgalltadghsgevlqmslnaat
flgqeptvlrgqtlaallpeqwpalqaalppgcpdalqyratldwpaaghlsltvhrvge
llilefepte
Timeline for d4q0ha1: