Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
Protein automated matches [190030] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries) |
Domain d4pzof_: 4pzo F: [258254] automated match to d1kw4a_ |
PDB Entry: 4pzo (more details), 2.25 Å
SCOPe Domain Sequences for d4pzof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pzof_ a.60.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} rtepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamnikrgpalk icarinslkes
Timeline for d4pzof_: