SCOPe 2.05: Domain d4pzof_: 4pzo F:

Lineage for d4pzof_ (4pzo F:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)

8. Domain d4pzof_: 4pzo F: [258254]
   automated match to d1kw4a_

Details for d4pzof_

PDB Entry: 4pzo, 2.25 Å

PDB Description: Crystal structure of PHC3 SAM L967R

PDB Compounds: (F:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pzof_:

Sequence; same for both SEQRES and ATOM records:

>d4pzof_ a.60.1.2 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamnikrgpalk
icarinslkes

Timeline for d4pzof_:

• d4pzof_ first appeared in SCOPe 2.04
  
• d4pzof_ is called d4pzof1 in SCOPe 2.06
  
• d4pzof_ appears in the current release, SCOPe 2.08, called d4pzof1