SCOPe 2.08: Domain d4pzof1: 4pzo F:914-983

Lineage for d4pzof1 (4pzo F:914-983)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)

8. Domain d4pzof1: 4pzo F:914-983 [258254]
   Other proteins in same PDB: d4pzoa2, d4pzob2, d4pzoc2, d4pzoe2, d4pzof2
   automated match to d1kw4a_

Details for d4pzof1

PDB Entry: 4pzo, 2.25 Å

PDB Description: Crystal structure of PHC3 SAM L967R

PDB Compounds: (F:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pzof1:

Sequence; same for both SEQRES and ATOM records:

>d4pzof1 a.60.1.2 (F:914-983) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamnikrgpalki
carinslkes

Timeline for d4pzof1:

• d4pzof1 first appeared in SCOPe 2.04, called d4pzof_
  
• d4pzof1 appears in SCOPe 2.07