SCOPe 2.07: Domain d4pznc1: 4pzn C:914-982

Lineage for d4pznc1 (4pzn C:914-982)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)

6. Protein automated matches [190030] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)

8. Domain d4pznc1: 4pzn C:914-982 [258251]
   Other proteins in same PDB: d4pznc2
   automated match to d1kw4a_
   complexed with edo

Details for d4pznc1

PDB Entry: 4pzn, 2.3 Å

PDB Description: Crystal structure of PHC3 SAM L971E

PDB Compounds: (C:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pznc1:

Sequence; same for both SEQRES and ATOM records:

>d4pznc1 a.60.1.2 (C:914-982) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamniklgpaeki
carinslke

Timeline for d4pznc1:

• d4pznc1 first appeared in SCOPe 2.04, called d4pznc_
  
• d4pznc1 appears in SCOPe 2.06