Lineage for d4pznd_ (4pzn D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2715427Fold a.60: SAM domain-like [47768] (17 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2715428Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2715476Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins)
  6. 2715544Protein automated matches [190030] (2 species)
    not a true protein
  7. 2715545Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)
  8. 2715552Domain d4pznd_: 4pzn D: [258250]
    Other proteins in same PDB: d4pznc2
    automated match to d1kw4a_
    complexed with edo

Details for d4pznd_

PDB Entry: 4pzn (more details), 2.3 Å

PDB Description: Crystal structure of PHC3 SAM L971E
PDB Compounds: (D:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pznd_ a.60.1.2 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamniklgpaeki
carinslke

SCOPe Domain Coordinates for d4pznd_:

Click to download the PDB-style file with coordinates for d4pznd_.
(The format of our PDB-style files is described here.)

Timeline for d4pznd_: