Lineage for d4pznb_ (4pzn B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324210Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 2324255Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 protein domains)
  6. 2324323Protein automated matches [190030] (2 species)
    not a true protein
  7. 2324324Species Human (Homo sapiens) [TaxId:9606] [187366] (4 PDB entries)
  8. 2324329Domain d4pznb_: 4pzn B: [258249]
    Other proteins in same PDB: d4pznc2
    automated match to d1kw4a_
    complexed with edo

Details for d4pznb_

PDB Entry: 4pzn (more details), 2.3 Å

PDB Description: Crystal structure of PHC3 SAM L971E
PDB Compounds: (B:) Polyhomeotic-like protein 3

SCOPe Domain Sequences for d4pznb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pznb_ a.60.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepsiwtvddvwafihslpgcqdiadefraqeidgqallllkedhlmsamniklgpaeki
carinslke

SCOPe Domain Coordinates for d4pznb_:

Click to download the PDB-style file with coordinates for d4pznb_.
(The format of our PDB-style files is described here.)

Timeline for d4pznb_: